| Protein or peptide name: | Mtln |
| Chromosome: | 2 |
| Protein or peptide start site: | 127792300 |
| Protein or peptide end site: | 127792467 |
| ncRNA start site: | 127791377 |
| ncRNA end site: | 127792488 |
| Genome Browser: | |
| Protein or peptide sequence: | MADVSERTLQVSVLVAFASGVVLGWQANRLRRRYLDWRKRRLQDKLATTQKKLDLA |
| Protein or peptide length: | 56aa |
| ncRNA type: | lncRNA |
| ncRNA name: | 1500011K16Rik |
| Entrez ID: | 67885 |
| Experimental species: | Mus musculus |
| Experimental techniques: | Immunoblotting/Immunocytochemistry |
| Experimental sample (cell line and/or tissue): | NIH 3T3/NS0 cells/Brain tissue/Liver tissue/Kidney tissue/Heart tissue/Lung tissue |
| Description: | Here we have demonstrated that one such transcript is translated into a 56-aminoacid-long peptide conserved in chordates. |
| Subcellular location: | mitochondria |
| Function: | Interaction of Mtln with NADH-dependent cytochrome b5 reductase stimulates complex I functioning most likely by providing a favorable lipid composition of the membrane. |
| Title of paper: | LINC00116 codes for a mitochondrial peptide linking respiration and lipid metabolism |
| PMID: | 30796188 |
| Year of publication: | 2018 |
